HOME

Mini Shell 1.0
Current File : //usr/share/locale/vi/LC_MESSAGES/xkeyboard-config.mo
��FL"�|DH[I[q^[b�[!3\U\l\�\�\�\�\�\�\�\]#)]M]k].�]�]�]�]
^	^^.^%:^$`^%�^�^�^�^�^�^C�^"*_M_)j_2�_�_
�_�_	�_	`
``'`3`?`[`a`�`�`O�`aa#a4aHa[ala~a�a�a�a�a�a�ab
b#bBbbbub�b4�b�b�b�b�bc
ccc'5c]cfc	|c�c�c	�c
�c	�c+�c	�cf�cWd_dfd"ud�d�d�d�de
e
e'e:eNeVene�e�e�e#�e$�ef:fGfXf"if%�f/�f&�f,	g#6g#Zg~g�g+�g*�g�g$h=hThlhF�h)�h)�h i(i<iQi	kiui �i�i�i�i�ij"*j#Mj	qj={jJ�j>kDCk�kf�kll0l.Gl@vl@�lF�l"?mbmkm~m+�m�m�m�mn,nFnVnfnvn~n�n�n�n
�n�n�n"�n"o!5oWolo�o�o�o�o�o-p,.p![p%}p�p5�p4�p%q
7qBqHq)]q%�q�q"�q�q�qr r'r7r'Jrrr�r�r�r�r�r'�r's7sSsfsss�s�s�s�s�s�s�s
t#t4t*=t#ht�t�t�t�t$�tC�tB@u0�u/�u�u7�u.v.?vnv~v�v �v�v�v w'w9wJwfw}w�w(�w�w%�wxx7x*Vx�x�x�x'�x3�x@$y*ey�y�y/�y�y'z0zMz4kz�z�z	�z�z�z3{6{?{Q{,i{�{.�{	�{	�{	�{	||| |%|-|K|#T| x|'�|$�|�|}}6}N}i}
q}}�}�}�}&�}'�}~7~%O~u~�~�~$�~2�~#3K)c��������.�"N�#q�)��
��̀"�#�))�S�p�+��1��&����-�G�Z�t�0����Ԃ��� �!�2�B�W�^�x�����%Ń
����(�5�'H�p��������Ԅ�"	�#,�)P�z���(��̅����+�0;�l�r�������ƆՆކ	���'�B�H�O�o�����!��!ȇ�
�"'�J�j�����ʈ+��*�6�G�
_�j�~�	��&��0��$�.�&D�0k�$��.��&�0�$H�.m�&��0Ë$�.�H�h�{�������ь�� �	?�I�\�r�����ʍύ	֍����
��0�*G�r���������Ў���
�$�%:�&`���������ɏ	����!�>�V�n�������������̐����*�F�^�{�������ԑ�
��<�V�^�e�w�#{�3��7Ӓ�+�3�G�^�(s�����"ϓ��!�>�O�)n�-��Ɣޔ���3�!M�o�	��8��ƕؕ
���;�=�VV���E�����1�
E�P�m����.��0ۗ�"�;�,U��� ��#Ø!�2	� <�+]�%����ə�$�(�0F�w�����Ț/ؚ.�47�
l�z�����
�� ˛	�
��4�&9� `�"��%��%ʜ"�&�	:�D�.X�����������ٝޝ!���#�6�Q�%l���(��מ)� �@4�"u�D��2ݟ�+*�#V�z�	����	����&��۠*�"�@�\�#w�#����ء-ߡ`
�qn�-�,�E;�`�����,�@�X�	n�x�����*�����
�-�c6�#��6�������
���"%�H�[�n�����������Ǧ Ϧ���&�'6�/^�%����%ʧ���
+�6�J�(f�,����!ب(��#�%:�+`�$����ũߩ ���3�Q�W�q���	����(��W�%?�)e�
����(��ޫ��
�	�#�W=�����'��٬���6�R�
f�q�y�
������!ϭ�!�#'�K�b�/}��� Į����+�E�_�r���+��(Я���	���
-�;�M�_�q�����
����԰"ܰ&��&�E�]�t�����0���#���96�p�����*����βղ��#�	;�.E�&t������� ͳ'�-�,D�q�������ƴ�7�9�O� l�����"��޵ �3�B�_��������$Ѷ$��&�B�J�^�o�������˷����!�	3�=�T�Z�i�!o�����øܸ���%�,�E�J�\�p�x�,��+ù+��;3�do�Ժ�� �'�/�?�K�]�t�&������˻��.�*M�x�	�������ͼ����-&�NT�����½ٽ����+)�6U���������ƾ
�
�"��B�c_�
ÿ.ѿ���1�7�/>�]n�v��C���[L����Q3������������������������������������������������������������������������������������"�%�(�+�.�2�5�8�;�>�A�D�G�J�M�P�S�W�Z�]�`�c�f�i�l�o�r�u�x�{�~��������������������������������������������������������������������������������������x
�i��,��#�$>�#c�����$������%�+�-E�"s�)��8����#�=�
X�	f�p���7��1��7�>�T�e�j�{�]��,��'�JG�G��)����	�	$�.�G�X�m�&�����������������������-�"H�k���#������%���")�-L�)z�"���� ��G�O�
j�x�	����������,���$�	C�M�Y�	b�
l�	w�4����i��6�H�#_�7��.��,��,�2D� w�������������;�([���(��+��'���(�9�,J�/w�:��0��;�1O�'��%����D��C&�.j�B�������Z9�:��:��
��.�G�c�#u�.����%��%��%%�K�+g�.����V��O"�Ur�Z��#�i6�����#��G��O?�Z��_��=J�������1�����.�K�i����������������
�)�->�%l�%��$�������2/�.b�.����J��I �5j�E����I��IG���
������3��2�C�2Y�%��(���������94�$n�'��/��#����!&�H�)h�������'��(���"�=�M� i�"������3��$�7�I�b�z�2��X��R�;o�5����E��=�3R�������%����:�W�m�4��������7��5�(N�w� ����1���'�";�0^�8��D��2
�%@�f�4|�!��2��3�4:�:o�������#��6
�FD�����%��H��.+�8Z�����������������*���-.�*\�1��.��%��"�$1�!V�$x�������#��"�!/�<Q�+��"���+��&�E�K�8b�G������!/�Q�0q���$������*� I�j�&��+��-�5�=�1U�)��,��4�(�<�2\�:��*������� �1� D�e�9y�����
�+��(�@�Z�y�!������&�.�5�,K�x�����4����%
�%3�Y�!y���'��,�.
�6<�!s���=��#�%#1)U@��!�#/N m��	�� � �8)$b��#�!�!">a����6�5L_"z����9�E-9sE�9�E-9sE�9�E-9sE�9�E-9sE�-�!	"<	$_	�	�	�	�	�	 �	
0
L
g
!�
)�
�
�
�
$
;F[r5��%�	0I_z��1�2
%:
`
o
�
�
�
�
�
%�
$:Vq�����D� >+]�*�&�)�$%> d�%�+�(�%+>j|&��0�K�J@$��"�"�8'`-~7��*//!_=�M�V
.d�	��9�5D
[Uf���	�`�^Sz�m�O["h��$��� N6F�"��2([ {#�!�8� +<2h� ��&�2:m���8�0
6>u��!��.�	#
-6;4r.�0�/270j5���<�8 #G k � "� 
� � #� � !!1!#P!%t!�!1�!�!)�! &"@G""�"D�"2�" ##+D# p#�#�#�#�#�#1�#!$4>$,s$%�$$�$2�$"%A%[%<k%��%�+&<�&;�&b:'��' (?(5[($�(�(
�(�(�(	)3#)W)!v)(�)�)��)&V*7}*�*�*�*�*�*�*$�*!+<+T+i+%x+�+(�+�+�+-�+',B,Q,j,C�,N�,1-G-/g-�-0�-�-�-
. &.-G.4u.�.0�.2�."./4Q/<�/3�/�/'0)?01i0�0�0�0$�0�01
01;11X1U�1;�1/2L2X2,v2�2�2�2
�2�2U3e3v33�3!�3%�34-(4.V4!�4
�4�4�4�4�45)'5Q5,i5(�5�5'�5A6F6%d6�6�6"�6�6�6747$M72r76�7�7�7�7�7�7
88<8N8#`8�8�8
�8 �8�8/�809(I9!r9 �90�9�9:>:U:'t:�:;�:�:�:
;?;];y;#�;/�;�;7�;2<AC<A�<�<�<#�<+=5J==�=5�= �=%>';> c>'�>+�>d�>=?&V?*}?"�?�?)�?@'@CA@"�@0�@�@�@A&A-CA-qA/�A�A"�A	B")B'LBtB1�B%�B�BC
"C0CKC!^C�C�C�C+�C$�CD!&DHD1aD�D�D�D#�D�D�DE1E*EE7pE6�E6�EF;.FdjF*�F�F0	G:GLGdG�G�G(�G)�G8HEHVHoH�H�H5�H1�H*I>I"NI$qI*�I�I�I �I%J@?Jp�J�JK& K$GKlK#�K�K>�KF�K+FLrL�L#�L)�L�L�L$MY3M��MNI'NqN�N�N�N�N=�NsO��O�P��PsmQ��Qs�R�RSS	SSSSS S#S&S*S-S0S3S7S:S=SASDSHSKSNSQSUSXS[S^SaSdSgSjSmSpSsSvSyS|S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�S�STTTTTTTTTT T$T'T+T.T1T4T7T:T=T@TDTGTJTMTPTSTVTYT]T`TcTfTiTlToTrTvTyT�6��l������5@��0*�]��!K6�^2���2�[��=��X�%�<�iKL19�o��>M��z��7z$U	�u�v%��+�
��@D$�3s�b-~�UM9�m�!�%�j�um/�i]�����(;��?2��=;�z�>�����;��������Z�C����f�l�{�����A13��k$d�*����������Wl��4s�do�Rym�@)��u��FB���GK��S����o�}��_����[��(E������	G	��Q
�b�q�q.j'�g]PTf[ �a��`��R�k���-�1�}+��� �qV�.�bn^�f��-J,L3�P�+�*�(�y|�J�./0E��-E�t�d��^9��c��7�=�>Q����?@t�B������)��:��,��(�8����,>��������y �:Nr��_E�q*_�"����K����XN�'&
�����������7|���U
<7am���W�BO��\���:SI�xFk�"5#G��!�����e�X���dR�p�58�|�����\��a8����e�oELI9��2M� �t��0&n���W���U�#(�9��p����F��+P�.%n@�4������t��v<e�x4���
z����c�"fp�g#Q8��C{Y�$F%v�C��{����TO���8L���0��M&6�\��`xw4��&���/�i���=��<�Z!�2?)}4����,~D���A��3��r�<B��a-�
W5�;����#crl�����S:b���	T�1�V���A��J�)S��|
j�v��w�e�/�w��`��������=D�p_�5&�I ������g���^��CZ�Yr
hh��s;����F�,�i���OhO���+{��6��yB:�����P�u��~����Q���wjY?���>�V��gH�NHN�.
�?0�X�C�����3�G���'*����6$�nA'��`�hY�J�H��#����Z�}����~"\]D��Aks�����1[�x/cI	�
"�R7D��T�����!H�)'��V��&lt;Less/Greater&gt;&lt;Less/Greater&gt; chooses 3rd level, acts as onetime lock when pressed together with another 3rd-level-chooser&lt;Less/Greater&gt; chooses 5th level, locks when pressed together with another 5th-level-chooser3rd level of &lt;Less/Greater&gt;3rd level of Caps Lock3rd level of Left Ctrl3rd level of Left Win3rd level of Menu3rd level of Right Ctrl3rd level of Right WinA4Tech KB-21A4Tech KBS-8A4Tech Wireless Desktop RFKB-23APL keyboard symbolsAPL keyboard symbols (APLX unified)APL keyboard symbols (Dyalog)APL keyboard symbols (IBM APL2)APL keyboard symbols (Manugistics APL*PLUS II)APL keyboard symbols (sax)APL keyboard symbols (unified)ATM/phone-styleAcer AirKey VAcer C300Acer Ferrari 4000Acer LaptopAdd the standard behavior to Menu keyAdding Esperanto supersigned lettersAdding currency signs to certain keysAdvance Scorpius KIAfghaniAkanAlbanianAlbanian (Plisi)Allow breaking grabs with keyboard actions (warning: security risk)Allow grab and window tree loggingAlt and Meta are on Alt keysAlt is mapped to Right Win, Super to MenuAlt is mapped to Win keys (and the usual Alt keys)Alt is swapped with WinAlt+Caps LockAlt+CtrlAlt+ShiftAlt+SpaceAlt/Win key behaviorAmharicAny Alt keyAny Win keyAny Win key (while pressed)AppleApple Aluminium Keyboard (ANSI)Apple Aluminium Keyboard (ISO)Apple Aluminium Keyboard (JIS)Apple Aluminium Keyboard: emulate PC keys (Print, Scroll Lock, Pause, Num Lock)Apple LaptopArabicArabic (Algeria)Arabic (Buckwalter)Arabic (Macintosh)Arabic (Morocco)Arabic (Pakistan)Arabic (Sun Type 6/7)Arabic (Syria)Arabic (azerty)Arabic (azerty/digits)Arabic (digits)Arabic (qwerty)Arabic (qwerty/digits)ArmenianArmenian (OLPC phonetic)Armenian (alternative eastern)Armenian (alternative phonetic)Armenian (eastern)Armenian (phonetic)Armenian (western)Asturian (Spain, with bottom-dot H and bottom-dot L)Asus LaptopAt bottom leftAt left of 'A'AtsinaAvatimeAvestanAzerbaijaniAzerbaijani (Cyrillic)Azona RF2300 wireless Internet KeyboardBTC 5090BTC 5113RF MultimediaBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Mini Wireless Internet and GamingBackslashBackslash chooses 3rd level, acts as onetime lock when pressed together with another 3rd-level-chooserBambaraBanglaBangla (India)Bangla (India, Baishakhi Inscript)Bangla (India, Baishakhi)Bangla (India, Bornona)Bangla (India, Probhat)Bangla (India, Uni Gitanjali)Bangla (Probhat)BashkirianBelarusianBelarusian (Latin)Belarusian (legacy)BelgianBelgian (ISO alternate)Belgian (Sun Type 6/7)Belgian (Sun dead keys)Belgian (Wang model 724 azerty)Belgian (alternative)Belgian (alternative, Latin-9 only)Belgian (alternative, Sun dead keys)Belgian (eliminate dead keys)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Berber (Algeria, Latin characters)Berber (Algeria, Tifinagh characters)Berber (Morocco, Tifinagh alternative phonetic)Berber (Morocco, Tifinagh alternative)Berber (Morocco, Tifinagh extended phonetic)Berber (Morocco, Tifinagh extended)Berber (Morocco, Tifinagh phonetic)Berber (Morocco, Tifinagh)BosnianBosnian (US keyboard with Bosnian digraphs)Bosnian (US keyboard with Bosnian letters)Bosnian (with Bosnian digraphs)Bosnian (with guillemets for quotes)Both Alt keys togetherBoth Ctrl keys togetherBoth Shift keys togetherBoth Shift keys together activate Caps Lock, one Shift key deactivatesBoth Shift keys together toggle Caps LockBoth Shift keys together toggle ShiftLockBrailleBraille (left hand)Braille (right hand)Brother Internet KeyboardBulgarianBulgarian (new phonetic)Bulgarian (traditional phonetic)BurmeseCameroon Multilingual (Dvorak)Cameroon Multilingual (azerty)Cameroon Multilingual (qwerty)Canadian MultilingualCanadian Multilingual (first part)Canadian Multilingual (second part)Caps LockCaps Lock (to first layout), Shift+Caps Lock (to last layout)Caps Lock (while pressed), Alt+Caps Lock does the original capslock actionCaps Lock acts as Shift with locking; Shift "pauses" Caps LockCaps Lock acts as Shift with locking; Shift doesn't affect Caps LockCaps Lock as CtrlCaps Lock chooses 3rd level, acts as onetime lock when pressed together with another 3rd-level-chooserCaps Lock is also a CtrlCaps Lock is disabledCaps Lock key behaviorCaps Lock toggles ShiftLock (affects all keys)Caps Lock toggles normal capitalization of alphabetic charactersCaps Lock uses internal capitalization; Shift "pauses" Caps LockCaps Lock uses internal capitalization; Shift doesn't affect Caps LockCatalan (Spain, with middle-dot L)CherokeeCherry B.UNLIMITEDCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (alternate option)Cherry CyBo@rd USB-HubCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressChicony Internet KeyboardChicony KB-9885Chicony KU-0108Chicony KU-0420ChineseChurch SlavonicChuvashChuvash (Latin)Classmate PCCloGaelachCoeur d'Alene SalishCompaq Easy Access KeyboardCompaq Internet Keyboard (13 keys)Compaq Internet Keyboard (18 keys)Compaq Internet Keyboard (7 keys)Compaq iPaq KeyboardCreative Desktop Wireless 7000Crimean Tatar (Dobruja Q)Crimean Tatar (Turkish Alt-Q)Crimean Tatar (Turkish F)Crimean Tatar (Turkish Q)CroatianCroatian (US keyboard with Croatian digraphs)Croatian (US keyboard with Croatian letters)Croatian (with Croatian digraphs)Croatian (with guillemets for quotes)Ctrl + Alt + BackspaceCtrl is mapped to Alt keys, Alt is mapped to Win keysCtrl is mapped to Win keys (and the usual Ctrl keys)Ctrl key positionCtrl+ShiftCzechCzech (Sun Type 6/7)Czech (UCW layout, accented letters only)Czech (US Dvorak with CZ UCW support)Czech (qwerty)Czech (qwerty, extended Backslash)Czech (with &lt;\|&gt; key)Czech Slovak and German (US)DTK2000DanishDanish (Dvorak)Danish (Macintosh)Danish (Macintosh, eliminate dead keys)Danish (Sun Type 6/7)Danish (Winkeys)Danish (eliminate dead keys)Default numeric keypad keysDellDell 101-key PCDell Laptop/notebook Inspiron 6xxx/8xxxDell Laptop/notebook Precision M seriesDell Latitude series laptopDell Precision M65Dell SK-8125Dell SK-8135Dell USB Multimedia KeyboardDexxa Wireless Desktop KeyboardDhivehiDiamond 9801 / 9802 seriesDutchDutch (Macintosh)Dutch (Sun Type 6/7)Dutch (Sun dead keys)Dutch (standard)DzongkhaElfdalian (Swedish, with combining ogonek)Enable extra typographic charactersEnglish (Australian)English (Cameroon)English (Canada)English (Carpalx)English (Carpalx, full optimization)English (Carpalx, full optimization, international AltGr dead keys)English (Carpalx, full optimization, international with dead keys)English (Carpalx, international AltGr dead keys)English (Carpalx, international with dead keys)English (Colemak)English (Dvorak alternative international no dead keys)English (Dvorak)English (Dvorak, international with dead keys)English (Ghana)English (Ghana, GILLBT)English (Ghana, multilingual)English (India, with rupee sign)English (Macintosh)English (Mali, US Macintosh)English (Mali, US international)English (Nigeria)English (Norman)English (Programmer Dvorak)English (South Africa)English (UK)English (UK, Colemak)English (UK, Dvorak with UK punctuation)English (UK, Dvorak)English (UK, Macintosh international)English (UK, Macintosh)English (UK, Sun Type 6/7)English (UK, extended WinKeys)English (UK, international with dead keys)English (US)English (US, IBM Arabic 238_L)English (US, Sun Type 6/7)English (US, alternative international)English (US, international AltGr Unicode combining)English (US, international AltGr Unicode combining, alternative)English (US, international with dead keys)English (US, with euro on 5)English (Workman)English (Workman, international with dead keys)English (classic Dvorak)English (international AltGr dead keys)English (left handed Dvorak)English (right handed Dvorak)English (the divide/multiply keys toggle the layout)Ennyah DKB-1008Enter on keypadEsperantoEsperanto (Brazil, Nativo)Esperanto (Portugal, Nativo)Esperanto (displaced semicolon and quote, obsolete)EstonianEstonian (Dvorak)Estonian (Sun Type 6/7)Estonian (US keyboard with Estonian letters)Estonian (eliminate dead keys)EurKEY (US based layout with european letters)Euro on 2Euro on 4Euro on 5Euro on EEverex STEPnoteEweFL90FaroeseFaroese (eliminate dead keys)FilipinoFilipino (Capewell-Dvorak Baybayin)Filipino (Capewell-Dvorak Latin)Filipino (Capewell-QWERF 2006 Baybayin)Filipino (Capewell-QWERF 2006 Latin)Filipino (Colemak Baybayin)Filipino (Colemak Latin)Filipino (Dvorak Baybayin)Filipino (Dvorak Latin)Filipino (QWERTY Baybayin)FinnishFinnish (DAS)Finnish (Macintosh)Finnish (Sun Type 6/7)Finnish (Winkeys)Finnish (classic)Finnish (classic, eliminate dead keys)Four-level key with abstract separatorsFour-level key with commaFour-level key with dotFour-level key with dot, Latin-9 onlyFour-level key with momayyezFrenchFrench (Azerty)French (Bepo, ergonomic, Dvorak way)French (Bepo, ergonomic, Dvorak way, Latin-9 only)French (Breton)French (Cameroon)French (Canada)French (Canada, Dvorak)French (Canada, legacy)French (Democratic Republic of the Congo)French (Dvorak)French (Guinea)French (Macintosh)French (Mali, alternative)French (Morocco)French (Sun Type 6/7)French (Sun dead keys)French (Switzerland)French (Switzerland, Macintosh)French (Switzerland, Sun Type 6/7)French (Switzerland, Sun dead keys)French (Switzerland, eliminate dead keys)French (Togo)French (alternative)French (alternative, Latin-9 only)French (alternative, Sun dead keys)French (alternative, eliminate dead keys)French (eliminate dead keys)French (legacy, alternative)French (legacy, alternative, Sun dead keys)French (legacy, alternative, eliminate dead keys)Fujitsu-Siemens Computers AMILO laptopFulaGaGeneric 101-key PCGeneric 102-key (Intl) PCGeneric 104-key PCGeneric 105-key (Intl) PCGenius Comfy KB-12eGenius Comfy KB-16M / Genius MM Keyboard KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGeorgianGeorgian (France, AZERTY Tskapo)Georgian (Italy)Georgian (MESS)Georgian (ergonomic)GermanGerman (Aus der Neo-Welt)German (Austria)German (Austria, Macintosh)German (Austria, Sun dead keys)German (Austria, eliminate dead keys)German (Bone)German (Bone, eszett home row)German (Dvorak)German (KOY)German (Macintosh)German (Macintosh, eliminate dead keys)German (Neo 2)German (Neo qwerty)German (Neo qwertz)German (Sun Type 6/7)German (Sun dead keys)German (Switzerland)German (Switzerland, Macintosh)German (Switzerland, Sun Type 6/7)German (Switzerland, Sun dead keys)German (Switzerland, eliminate dead keys)German (Switzerland, legacy)German (T3)German (US keyboard with German letters)German (dead acute)German (dead grave acute)German (dead tilde)German (eliminate dead keys)German (qwerty)German (with Hungarian letters and no dead keys)GreekGreek (Sun Type 6/7)Greek (eliminate dead keys)Greek (extended)Greek (polytonic)Greek (simple)GujaratiGyrationHTC DreamHappy Hacking KeyboardHappy Hacking Keyboard for MacHardware Hangul/Hanja keysHausaHebrewHebrew (Biblical, SIL phonetic)Hebrew (Biblical, Tiro)Hebrew (lyx)Hebrew (phonetic)Hewlett-Packard Internet KeyboardHewlett-Packard Mini 110 NotebookHewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 5xxHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT11xxHewlett-Packard Pavilion dv5Hewlett-Packard SK-250x Multimedia KeyboardHewlett-Packard nx9020HexadecimalHindi (Bolnagri)Hindi (KaGaPa phonetic)Hindi (Wx)Honeywell EuroboardHtc Dream phoneHungarianHungarian (101/qwerty/comma/dead keys)Hungarian (101/qwerty/comma/eliminate dead keys)Hungarian (101/qwerty/dot/dead keys)Hungarian (101/qwerty/dot/eliminate dead keys)Hungarian (101/qwertz/comma/dead keys)Hungarian (101/qwertz/comma/eliminate dead keys)Hungarian (101/qwertz/dot/dead keys)Hungarian (101/qwertz/dot/eliminate dead keys)Hungarian (102/qwerty/comma/dead keys)Hungarian (102/qwerty/comma/eliminate dead keys)Hungarian (102/qwerty/dot/dead keys)Hungarian (102/qwerty/dot/eliminate dead keys)Hungarian (102/qwertz/comma/dead keys)Hungarian (102/qwertz/comma/eliminate dead keys)Hungarian (102/qwertz/dot/dead keys)Hungarian (102/qwertz/dot/eliminate dead keys)Hungarian (eliminate dead keys)Hungarian (qwerty)Hungarian (standard)Hyper is mapped to Win keysIBM Rapid AccessIBM Rapid Access IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tIcelandicIcelandic (Dvorak)Icelandic (Macintosh)Icelandic (Macintosh, legacy)Icelandic (Sun dead keys)Icelandic (eliminate dead keys)IgboIndianInuktitutIraqiIrishIrish (UnicodeExpert)ItalianItalian (IBM 142)Italian (Macintosh)Italian (Sun Type 6/7)Italian (US keyboard with Italian letters)Italian (Winkeys)Italian (eliminate dead keys)JapaneseJapanese (Dvorak)Japanese (Kana 86)Japanese (Kana)Japanese (Macintosh)Japanese (OADG 109A)Japanese (PC-98xx Series)Japanese (Sun Type 6)Japanese (Sun Type 7 - pc compatible)Japanese (Sun Type 7 - sun compatible)Japanese keyboard optionsKalmykKana Lock key is lockingKannadaKannada (KaGaPa phonetic)KashubianKazakhKazakh (extended)Kazakh (with Russian)Key sequence to kill the X serverKey to choose 3rd levelKey to choose 5th levelKeytronic FlexProKhmer (Cambodia)KikuyuKinesisKomiKoreanKorean (101/104 key compatible)Korean (Sun Type 6/7)Korean Hangul/Hanja keysKurdish (Iran, Arabic-Latin)Kurdish (Iran, F)Kurdish (Iran, Latin Alt-Q)Kurdish (Iran, Latin Q)Kurdish (Iraq, Arabic-Latin)Kurdish (Iraq, F)Kurdish (Iraq, Latin Alt-Q)Kurdish (Iraq, Latin Q)Kurdish (Syria, F)Kurdish (Syria, Latin Alt-Q)Kurdish (Syria, Latin Q)Kurdish (Turkey, F)Kurdish (Turkey, Latin Alt-Q)Kurdish (Turkey, Latin Q)KutenaiKyrgyzKyrgyz (phonetic)LaoLao (STEA proposed standard layout)Laptop/notebook Compaq (eg. Armada) Laptop KeyboardLaptop/notebook Compaq (eg. Presario) Internet KeyboardLaptop/notebook eMachines m68xxLatvianLatvian (F variant)Latvian (Sun Type 6/7)Latvian (US Colemak)Latvian (US Colemak, apostrophe variant)Latvian (US Dvorak)Latvian (US Dvorak, Y variant)Latvian (US Dvorak, minus variant)Latvian (adapted)Latvian (apostrophe variant)Latvian (ergonomic, ŪGJRMV)Latvian (modern)Latvian (programmer US Dvorak)Latvian (programmer US Dvorak, Y variant)Latvian (programmer US Dvorak, minus variant)Latvian (tilde variant)Layout of numeric keypadLeft AltLeft Alt (while pressed)Left Alt as Ctrl, Left Ctrl as Win, Left Win as AltLeft Alt is swapped with Left WinLeft Alt+Left ShiftLeft CtrlLeft Ctrl (to first layout), Right Ctrl (to last layout)Left Ctrl as MetaLeft Ctrl+Left ShiftLeft ShiftLeft WinLeft Win (to first layout), Right Win/Menu (to last layout)Left Win (while pressed)Left Win chooses 5th level, locks when pressed together with another 5th-level-chooserLeftCtrl+LeftWinLeftCtrl+LeftWin (to first layout), RightCtrl+Menu (to second layout)LegacyLegacy Wang 724Legacy key with commaLegacy key with dotLithuanianLithuanian (IBM LST 1205-92)Lithuanian (LEKP)Lithuanian (LEKPa)Lithuanian (Sun Type 6/7)Lithuanian (US Dvorak with Lithuanian letters)Lithuanian (US keyboard with Lithuanian letters)Lithuanian (standard)Logitech Access KeyboardLogitech Cordless DesktopLogitech Cordless Desktop (alternate option)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (alternate option 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 extra keys via G15daemonLogitech Generic KeyboardLogitech Internet 350 KeyboardLogitech Internet KeyboardLogitech Internet Navigator KeyboardLogitech Media Elite KeyboardLogitech Ultra-X Cordless Media Desktop KeyboardLogitech Ultra-X KeyboardLogitech diNovo Edge KeyboardLogitech diNovo KeyboardLogitech iTouchLogitech iTouch Cordless Keyboard (model Y-RB6)Logitech iTouch Internet Navigator Keyboard SELogitech iTouch Internet Navigator Keyboard SE (USB)Lower SorbianLower Sorbian (qwertz)MacBook/MacBook ProMacBook/MacBook Pro (Intl)MacedonianMacedonian (eliminate dead keys)MacintoshMacintosh OldMaintain key compatibility with old Solaris keycodesMake Caps Lock an additional BackspaceMake Caps Lock an additional ESCMake Caps Lock an additional HyperMake Caps Lock an additional Menu keyMake Caps Lock an additional Num LockMake Caps Lock an additional SuperMake Zenkaku Hankaku an additional ESCMalayalamMalayalam (Lalitha)Malayalam (enhanced Inscript, with rupee sign)MalteseMaltese (with US layout)Manipuri (Eeyek)MaoriMarathi (KaGaPa phonetic)MariMemorex MX1998Memorex MX2500 EZ-Access KeyboardMemorex MX2750MenuMenu as Right CtrlMeta is mapped to Left WinMeta is mapped to Win keysMicrosoft Comfort Curve Keyboard 2000Microsoft Internet KeyboardMicrosoft Internet Keyboard Pro, SwedishMicrosoft NaturalMicrosoft Natural Ergonomic Keyboard 4000Microsoft Natural Keyboard EliteMicrosoft Natural Keyboard Pro / Microsoft Internet Keyboard ProMicrosoft Natural Keyboard Pro OEMMicrosoft Natural Keyboard Pro USB / Microsoft Internet Keyboard ProMicrosoft Natural Wireless Ergonomic Keyboard 7000Microsoft Office KeyboardMicrosoft Wireless Multimedia Keyboard 1.0AMiscellaneous compatibility optionsMmuockMoldavianMoldavian (Gagauz)MongolianMontenegrinMontenegrin (Cyrillic with guillemets)Montenegrin (Cyrillic)Montenegrin (Cyrillic, ZE and ZHE swapped)Montenegrin (Latin Unicode qwerty)Montenegrin (Latin Unicode)Montenegrin (Latin qwerty)Montenegrin (Latin with guillemets)Multilingual (Canada, Sun Type 6/7)NICOLA-F style BackspaceNepaliNon-breakable space character at fourth levelNon-breakable space character at fourth level, thin non-breakable space character at sixth levelNon-breakable space character at fourth level, thin non-breakable space character at sixth level (via Ctrl+Shift)Non-breakable space character at second levelNon-breakable space character at third levelNon-breakable space character at third level, nothing at fourth levelNon-breakable space character at third level, thin non-breakable space character at fourth levelNorthern Saami (Finland)Northern Saami (Norway)Northern Saami (Norway, eliminate dead keys)Northern Saami (Sweden)Northgate OmniKey 101NorwegianNorwegian (Colemak)Norwegian (Dvorak)Norwegian (Macintosh)Norwegian (Macintosh, eliminate dead keys)Norwegian (Sun Type 6/7)Norwegian (Winkeys)Norwegian (eliminate dead keys)Num LockNumLock on: digits, Shift switches to arrow keys, Numlock off: always arrow keys (as in MS Windows)Numeric keypad delete key behaviourNumeric keypad keys always enter digits (as in Mac OS)OLPCOccitanOghamOgham (IS434)Ol ChikiOriyaOrtek MCK-800 MM/Internet keyboardOssetian (Georgia)Ossetian (WinKeys)Ossetian (legacy)PC-98xx SeriesPannonian RusynPashtoPashto (Afghanistan, OLPC)PausePersianPersian (Afghanistan, Dari OLPC)Persian (with Persian keypad)PolishPolish (Colemak)Polish (Dvorak)Polish (Dvorak, Polish quotes on key 1)Polish (Dvorak, Polish quotes on quotemark key)Polish (Germany, eliminate dead keys)Polish (Sun Type 6/7)Polish (international with dead keys)Polish (legacy)Polish (programmer Dvorak)Polish (qwertz)PortuguesePortuguese (Brazil)Portuguese (Brazil, Dvorak)Portuguese (Brazil, IBM/Lenovo ThinkPad)Portuguese (Brazil, Nativo for US keyboards)Portuguese (Brazil, Nativo)Portuguese (Brazil, Sun Type 6/7)Portuguese (Brazil, eliminate dead keys)Portuguese (Macintosh)Portuguese (Macintosh, Sun dead keys)Portuguese (Macintosh, eliminate dead keys)Portuguese (Nativo for US keyboards)Portuguese (Nativo)Portuguese (Sun Type 6/7)Portuguese (Sun dead keys)Portuguese (eliminate dead keys)Position of Compose keyPropeller Voyager (KTEZ-1000)PrtScPunjabi (Gurmukhi Jhelum)Punjabi (Gurmukhi)QTronix Scorpius 98N+Right AltRight Alt (while pressed)Right Alt as Hangul, right Ctrl as HanjaRight Alt chooses 5th level, locks when pressed together with another 5th-level-chooserRight Alt key never chooses 3rd levelRight Alt, Shift+Right Alt key is ComposeRight CtrlRight Ctrl (while pressed)Right Ctrl as Hangul, right Alt as HanjaRight Ctrl as Right AltRight Ctrl+Right ShiftRight ShiftRight WinRight Win (while pressed)Right Win chooses 5th level, locks when pressed together with another 5th-level-chooserRomanianRomanian (Germany)Romanian (Germany, eliminate dead keys)Romanian (Sun Type 6/7)Romanian (WinKeys)Romanian (cedilla)Romanian (ergonomic Touchtype)Romanian (standard cedilla)Romanian (standard)Rupee on 4RussianRussian (Czech, phonetic)Russian (DOS)Russian (Georgia)Russian (Germany, phonetic)Russian (Kazakhstan, with Kazakh)Russian (Macintosh)Russian (Poland, phonetic Dvorak)Russian (Rulemak, phonetic Colemak)Russian (Sun Type 6/7)Russian (Sweden, phonetic)Russian (Sweden, phonetic, eliminate dead keys)Russian (US, phonetic)Russian (Ukraine, standard RSTU)Russian (legacy)Russian (phonetic French)Russian (phonetic WinKeys)Russian (phonetic azerty)Russian (phonetic dvorak)Russian (phonetic)Russian (typewriter)Russian (typewriter, legacy)Russian (with Ukrainian-Belorussian layout)SILVERCREST Multimedia Wireless KeyboardSK-1300SK-2500SK-6200SK-7100SVEN Ergonomic 2500SVEN Slim 303Saisiyat (Taiwan)Samsung SDM 4500PSamsung SDM 4510PSanskrit (KaGaPa phonetic)Sanwa Supply SKB-KG3Scroll LockSecwepemctsinSemicolon on third levelSerbianSerbian (Cyrillic with guillemets)Serbian (Cyrillic, ZE and ZHE swapped)Serbian (Latin Unicode qwerty)Serbian (Latin Unicode)Serbian (Latin qwerty)Serbian (Latin with guillemets)Serbian (Latin)Serbian (Russia)Serbian (combining accents instead of dead keys)Serbo-Croatian (US)Shift + NumLock toggles PointerKeysShift cancels Caps LockShift does not cancel Num Lock, chooses 3rd level insteadShift+Caps LockSilesianSindhiSinhala (US keyboard with Sinhala letters)Sinhala (phonetic)SlovakSlovak (Sun Type 6/7)Slovak (extended Backslash)Slovak (qwerty)Slovak (qwerty, extended Backslash)SlovenianSlovenian (US keyboard with Slovenian letters)Slovenian (with guillemets for quotes)SpanishSpanish (Dvorak)Spanish (Latin American)Spanish (Latin American, Dvorak)Spanish (Latin American, Sun dead keys)Spanish (Latin American, eliminate dead keys)Spanish (Latin American, include dead tilde)Spanish (Macintosh)Spanish (Sun Type 6/7)Spanish (Sun dead keys)Spanish (Winkeys)Spanish (eliminate dead keys)Spanish (include dead tilde)Special keys (Ctrl+Alt+&lt;key&gt;) handled in a serverSun Key compatibilitySun Type 6 (Japanese layout)Sun Type 6 USB (Japanese layout)Sun Type 6 USB (Unix layout)Sun Type 6/7 USBSun Type 6/7 USB (European layout)Sun Type 7 USBSun Type 7 USB (European layout)Sun Type 7 USB (Japanese layout) / Japanese 106-keySun Type 7 USB (Unix layout)Super Power Multimedia KeyboardSwahili (Kenya)Swahili (Tanzania)Swap Ctrl and Caps LockSwap ESC and Caps LockSwap Left Alt key with Left Ctrl keySwap Left Win key with Left Ctrl keySwap Right Win key with Right Ctrl keySwedishSwedish (Dvorak A5)Swedish (Dvorak)Swedish (Macintosh)Swedish (Sun Type 6/7)Swedish (Svdvorak)Swedish (eliminate dead keys)Swedish Sign LanguageSwitching to another layoutSymplon PaceBook (tablet PC)SyriacSyriac (phonetic)TaiwaneseTaiwanese (indigenous)TajikTajik (legacy)TamilTamil (Sri Lanka, TAB Typewriter)Tamil (Sri Lanka, Unicode)Tamil (TAB typewriter)Tamil (TSCII typewriter)Tamil (Unicode)Tamil (keyboard with numerals)Targa Visionary 811TatarTeluguTelugu (KaGaPa phonetic)ThaiThai (Pattachote)Thai (TIS-820.2538)TibetanTibetan (with ASCII numerals)To the corresponding key in a Colemak layoutTo the corresponding key in a Dvorak layoutTo the corresponding key in a Qwerty layoutToshiba Satellite S3000Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Trust Direct Access KeyboardTrust SlimlineTrust Wireless Keyboard ClassicTswanaTurkishTurkish (Alt-Q)Turkish (F)Turkish (Germany)Turkish (Sun Type 6/7)Turkish (Sun dead keys)Turkish (international with dead keys)TurkmenTurkmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (102/105:EU mode)TypeMatrix EZ-Reach 2030 USB (106:JP mode)UdmurtUkrainianUkrainian (Sun Type 6/7)Ukrainian (WinKeys)Ukrainian (homophonic)Ukrainian (legacy)Ukrainian (phonetic)Ukrainian (standard RSTU)Ukrainian (typewriter)Unicode additions (arrows and math operators)Unicode additions (arrows and math operators; math operators on default level)Unitek KB-1925Urdu (Pakistan)Urdu (Pakistan, CRULP)Urdu (Pakistan, NLA)Urdu (WinKeys)Urdu (alternative phonetic)Urdu (phonetic)Use keyboard LED to show alternative layoutUsing space key to input non-breakable space characterUsual space at any levelUyghurUzbekUzbek (Afghanistan)Uzbek (Afghanistan, OLPC)Uzbek (Latin)VietnameseViewSonic KU-306 Internet KeyboardWang 724 keypad with Unicode additions (arrows and math operators)Wang 724 keypad with Unicode additions (arrows and math operators; math operators on default level)Win Key+SpaceWin is mapped to PrtSc (and the usual Win key)Winbook Model XP5WolofYahoo! Internet KeyboardYakutYorubaZero-width non-joiner character at second levelZero-width non-joiner character at second level, non-breakable space character at third levelZero-width non-joiner character at second level, non-breakable space character at third level, nothing at fourth levelZero-width non-joiner character at second level, non-breakable space character at third level, thin non-breakable space at fourth levelZero-width non-joiner character at second level, non-breakable space character at third level, zero-width joiner at fourth levelZero-width non-joiner character at second level, zero-width joiner character at third levelZero-width non-joiner character at second level, zero-width joiner character at third level, non-breakable space character at fourth levelZero-width non-joiner character at third level, zero-width joiner at fourth levelakamaplapl2aplIIaplxaravnazbeberbgbmbnbrlbsbychrcmcrhcsdadedlgdvdzeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyieigikeinisitjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmtmynenlnoorpaphplpsptrorusasatsaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozhProject-Id-Version: xkeyboard-config 2.19.99
Report-Msgid-Bugs-To: svu@users.sourceforge.net
PO-Revision-Date: 2017-01-12 09:26+0700
Last-Translator: Trần Ngọc Quân <vnwildman@gmail.com>
Language-Team: Vietnamese <translation-team-vi@lists.sourceforge.net>
Language: vi
X-Bugs: Report translation errors to the Language-Team address.
MIME-Version: 1.0
Content-Type: text/plain; charset=UTF-8
Content-Transfer-Encoding: 8bit
Plural-Forms: nplurals=1; plural=0;
X-Generator: Gtranslator 2.91.7
&lt;Nhỏ/Lớn hơn&gt;&lt;Nhỏ/Lớn hơn&gt; chọn cấp 3, hành động một lần khóa khi bấm cùng với các chọn cấp 3 khác&lt;Nhỏ/Lớn hơn&gt; chọn cấp năm, khóa khi bấm nhau với một bộ chọn cấp năm khácMức thứ 3 của &lt;Nhỏ/Lớn hơn&gt;Mức thứ 3 của phím Caps LockMức thứ 3 của phím Ctrl tráiMức thứ 3 của phím Win tráiMức thứ 3 của phím MenuMức thứ 3 của Ctrl phảiMức thứ 3 của phím Win phảiA4Tech KB-21A4Tech KBS-8Không dây Để bàn RFKB-23 A4TechKý hiệu bàn phím APLCác ký hiệu bàn phím APL (APLX unified)Ký hiệu bàn phím APL (Dyalog)Các ký hiệu bàn phím APL (IBM APL2)Các ký hiệu bàn phím APL (Manugistics APL*PLUS II)Ký hiệu bàn phím APL (sax)Ký hiệu bàn phím APL (unified)Kiểu điện thoại/ATMAcer AirKey VAcer C300Acer Ferrari 4000Máy tính xách tay AcerThêm ứng xử tiêu chuẩn vào phím trình đơn.Đang thêm các dấu mũ tiếng Ét-pe-ran-tôĐang thêm ký hiệu tiền tệ vào phím nào đóNâng cao Scorpius KITiếng Ap-ga-niAkanTiếng An-ba-niTiếng An-ba-ni (Plisi)Cho bắt ngắt với thao tác của bàn phím (cảnh báo: tiềm ẩn nhiều rủi ro)Cho bắt và ghi nhật ký cây cửa sổAlt và Meta nằm trên các phím AltÁnh xạ Alt sang phím Win bên phải và Super sang phím trình đơnAlt ánh xạ tới các phím Win (và các phím Alt thường dùng)Alt được tráo đổi với phím WinAlt+CapsLockAlt+CtrlAlt+ShiftAlt+SpaceỨng xử phím Alt/WinTiếng Am-ha-riBất kỳ phím AltBất kỳ phím WinBất kỳ phím Win (trong khi bấm)AppleBàn phím nhôm Apple (ANSI)Bàn phím nhôm Apple (ISO)Bàn phím nhôm Apple (JIS)Bàn phím nhôm Apple: mô phỏng phím PC: Print (In), Scroll_Lock (Khóa cuộn), Pause (Tạm dừng), NumLock (Khóa số)Máy tính xách tay AppleTiếng Ả RậpTiếng Ả Rập (An-gê-ri)Tiếng Ả Rập (Buckwalter)Tiếng Ả Rập (Macintosh)Tiếng Ả Rập (Ma-rốc)Ả Rập (Pa-ki-x-thănh)Tiếng Ả rập (Kiểu Sun 6/7)Tiếng A Rập (Xy-ri)Tiếng A-rập (azerty)Tiếng A-rập (azerty/chữ số)A-rập (chữ số)Tiếng Ả Rập (qwerty)Tiếng Ả rập (qwerty/chữ số)Tiếng Ác-mê-niTiếng Ac-mê-ni (ngữ âm OLPC)Tiếng Ác-mê-ni (miền đông thay thế)Tiếng Ác-mê-ni (ngữ âm thay thế)Tiếng Ác-mê-ni (miền đông)Tiếng Ác-mê-ni (ngữ âm)Tiếng Ác-mê-ni (miền tây)Tiếng Biến thế Ax-tu-ri có H chấm dưới và L chấm dướiMấy tính xách tay AsusDưới tráiBên trái của “A”Át-xi-naAvatimeTiếng A-ve-x-tanhTiếng AgiecbaigiăngTiếng Agiecbaigiăng (Ki-rin)Bàn phím không dây Internet Azona RF2300BTC 5090BTC 5113RF đa phương tiệnBTC 5126TBTC 6301URFBTC 9000BTC 9000ABTC 9001AHBTC 9019UBTC 9116U Internet và Chạy trò Không dây NhỏGạch chéo ngượcBackslash chọn cấp 3, thực hiện khóa một lần khi bấm với một bộ chọn cấp 3 khácTiếng Bam-ba-raTiếng Băng-la-đétTiếng Băng-la-đét (Ấn-độ)Tiếng Băng-la-đét (Ấn-độ, Baishakhi Inscript)Tiếng Băng-la-đét (Ấn-độ, Baishakhi)Tiếng Băng-la-đét (Ấn-độ, Bornona)Tiếng Băng-la-đét (Ấn-độ, Probhat)Tiếng Băng-la-đét (Ấn-độ, Uni Gitanjali)Tiếng Băng-la-đét (Probhat)Tiếng Ba-s-khi-riTiếng Be-la-ruxợTiếng Be-la-ru (La-tinh)Tiếng Be-la-ru (cổ)Tiếng BỉTiếng Bỉ (ISO Xen kẽ)Tiếng Bỉ (Kiểu Sun 6/7)Tiếng Bỉ (phím chết Sun)Tiếng Bỉ (Wang mô hình 724 azerty)Tiếng Bỉ (thay thế)Tiếng Bỉ (thay thế, chỉ Latin-9)Tiếng Bỉ (thay thế, phím chết Sun)Tiếng Bỉ (loại bỏ phím chết)BenQ X-TouchBenQ X-Touch 730BenQ X-Touch 800Tiếng Berber (An-gê-ri, ký tự La-tinh)Tiếng Berber (An-gê-ri, ký tự Ti-phi-nac)Tiếng Berber (Ma Rốc, Ti-phi-nac ngữ âm thay thế)Tiếng Berber (Ma Rốc, Ti-phi-nac thay thế)Tiếng Berber (Ma Rốc, Ti-phi-nac mở rộng ngữ âm)Tiếng Berber (Ma Rốc, Ti-phi-nac mở rộng)Berber (Ma Rốc, Ti-phi-nac ngữ âm)Tiếng Berber (Ma Rốc, Ti-phi-nac)Tiếng Bô-xni-aTiếng Bo-x-ni-a (Bàn phím Mỹ với các chữ ghép Bo-x-ni-a)Tiếng Bo-x-ni-a (Bàn phím Mỹ với các chữ cái Bo-x-ni-a)Tiếng Bo-x-ni-a (Dùng chữ ghép Bo-x-ni-aTiếng Bo-x-ni-a (Dùng “guillemets” làm dấu trích dẫn)Cả hai phím Alt với nhauCả hai phím Ctrl với nhauCả hai phím Shift với nhauCả hai phím Shift với nhau thì kích hoạt Caps Lock, một Shift bỏ kích hoạtCả hai phím Shift với nhau thì bật/tắt Caps LockCả hai phím Shift với nhau thì bật/tắt ShiftLockChữ nổiChữ nổi (tay trái)Chữ nổi (tay phải)Bàn phím Internet BrotherTiếng Bun-ga-riTiếng Bun-ga-ri (ngữ âm mới)Tiếng Bun-ga-ri (ngữ âm truyền thống)Tiếng Mi-an-maTiếng Ca-mơ-run đa ngữ (Dvorak)Tiếng Ca-mơ-run đa ngữ (azerty)Tiếng Ca-mơ-run đa ngữ (qwerty)Tiếng Ca-na-đa đa ngữTiếng Ca-na-đa đa ngữ (phần đầu)Tiếng Ca-na-đa đa ngữ (phần thứ hai)CapsLockCapsLock (tới bố trí đầu tiên), Shift+CapsLock (tới bố trí cuối cùng)CapsLock (trong khi bấm), Alt+CapsLock thì làm việc gốc khóa chữ hoaCapsLock hoạt động như Shift mà cũng khóa; Shift “tạm dừng” CapsLockCapsLock hoạt động như Shift mà cũng khóa; Shift không có tác động CapsLockCaps Lock là CtrlCaps Lock chọn cấp 3, thực hiện khóa một lần khi bấm với một bộ chọn cấp 3 khácCaps Lock cũng là một CtrlCapsLock bị tắtĐặc điểm của phím CapsLockCapsLock bật tắt ShiftLock (mọi phím đều bị ảnh hưởng)CapsLock bật tắt viết hoa thông thường của các ký tự chữ cáiCapsLock sử dụng chức năng viết hoa nội bộ; Shift “tạm dừng” CapsLockCapsLock sử dụng chức năng viết hoa nội bộ; Shift không có tác động CapsLockTiếng Ca-ta-lăng (Tây Ban Nha, có chữ L chấm giữa)Tiếng Che-rô-kiCherry B.VÔ_HẠNCherry Blue Line CyBo@rdCherry Blue Line CyBo@rd (tùy chọn thay thế)Cherry CyBo@rd Cái Nối USBCherry CyMotion ExpertCherry CyMotion Master LinuxCherry CyMotion Master XPressBàn phím Internet ChiconyChicony KB-9885Chicony KU-0108Chicony KU-0420Tiếng Trung QuốcTiếng Xla-vơ nhà thơTiếng Chu-vasợTiếng Chuvash (La-tinh)Classmate PCCloGaelachCoeur d'Alene SalishBàn phím Truy cập Dễ dàng của CompaqBàn phím Internet Compaq (13 phím)Bàn phím Internet Compaq (18 phím)Bàn phím Internet Compaq (7 phím)Bàn phím iPaq CompaqCreative Desktop Wireless 7000Tiếng Tác-ta (Dobruja Q)Tiếng Ta-tă Cợ-ri-mia (Thổ Nhĩ Kỳ Alt-Q)Tiếng Ta-tă Cợ-ri-mia (Thổ Nhĩ Kỳ F)Tiếng Ta-tă Cợ-ri-mia (Thổ Nhĩ Kỳ Q)Tiếng Croát-chi-aTiếng Croát-chi-a (Bàn phím Mỹ với các chữ ghép Croát-chi-a)Tiếng Croát-chi-a (Bàn phím Mỹ với các chữ cái Croát-chi-a)Tiếng Croát-chi-a (với chữ ghép Croát-chi-a)Tiếng Croát-chi-a (Dùng “guillemets” làm dấu trích dẫn)Ctrl + Alt + BackspaceCtrl ánh xạ tới các phím Alt, phím Alt lại ánh xạ đến WinCtrl ánh xạ tới các phím Win (và các phím Ctrl thường dùng)Vị trí phím CtrlCtrl+ShiftTiếng SécTiếng Séc (Kiểu Sun 6/7)Tiếng Séc (Bố trí UCW, chỉ chữ có dấu)Tiếng Séc (Mỹ Dvorak cũng hỗ trợ CZ UCW)Tiếng Séc (qwerty)Tiếng Séc (qwerty, Gạch ngược mở rộng)Tiếng Séc (với phím &lt;\|&gt;)Tiếng Slô-vác Séc và Đức (Mỹ)DTK2000Tiếng Đan MạchTiếng Đan Mạch (Dvorak)Tiếng Đan Mạch (Macintosh)Tiếng Đan Mạch (Macintosh, loại bỏ phím chết)Tiếng Đan-mạch (Kiểu Sun 6/7)Tiếng Đan Mạch (Có phím Windows)Tiếng Đan Mạch ( loại bỏ phím chết)Các phím vùng số mặc địnhDellDell PC 101 phímXách tay Dell Inspiron 6xxx/8xxxXách tay Dell dãy Precision MMáy tính xách tay Dell sê-ri LatitudeDell Precision M65Dell SK-8125Dell SK-8135Bàn phím đa phương tiện USB DellBàn phím Không dây Dexxa cho DesktopTiếng Đi-ve-hiSê ri Diamond 9801 / 9802Tiếng Hà LanTiếng Hà Lan (Macintosh)Tiếng Hà-lan (Kiểu Sun 6/7)Tiếng Hà Lan (Phím chết Sun)Tiếng Hà Lan (tiêu chuẩn)Tiếng DzongkhaElfdalian (Thụy Điển, với ogonek tổ hợp)Bật thêm ký tự thuật in máyTiếng Anh (Úc)Tiếng Anh (Ca-mơ-run)Tiếng Anh (Ca-na-đa)Tiếng Anh (Carpalx)Tiếng Anh (Carpalx, tối ưu hóa toàn diện)Tiếng Anh (Carpalx, tối ưu hóa toàn diện, quốc tế với phím chết AltGr)Tiếng Anh (Carpalx, tối ưu hóa toàn diện, quốc tế với phím chết)Tiếng Anh (Carpalx, quốc tế với phím chết AltGr)Tiếng Anh (Carpalx, quốc tế với phím chết)Tiếng Anh (Colemak)Tiếng Anh (Dvorak quốc tế thay thế (không có phím chết))Tiếng Anh (Dvorak)Tiếng Anh (Dvorak quốc tế với phím chết)Tiếng Anh (Cộng hòa Ga-na)Tiếng Anh (Ghana, GILLBT)Tiếng Anh (Ga-na, đa ngữ)Tiếng Anh (Mỹ với euro trên 5)Tiếng Anh (Macintosh)Anh (Mali, Macintosh Mỹ)Anh (Mali, Mỹ quốc tế)Tiếng Anh (Nigeria)Tiếng Anh (Nóoc-măng)Tiếng Anh (Dvorak dành cho người lập trình)Tiếng Anh (Nam Phi)Tiếng Anh (UK)Tiếng Anh (UK, Colemak)Tiếng Anh (Mỹ, Dvorak dấu chấm câu Anh Quốc)Tiếng Anh (UK, Dvorak)Tiếng Anh (Anh, Macintosh quốc tế)Tiếng Anh (UK, Macintosh)Tiếng Anh (UK, Kiểu Sun 6/7)Tiếng Anh (UK, WinKeys)Tiếng Anh (Anh, quốc tế với phím chết)Tiếng Anh (Mỹ)Tiếng Anh (Mỹ, IBM Ả-rập 238_L)Tiếng Anh (Mỹ, Kiểu Sun 6/7)Tiếng Anh (Mỹ, thay thế bản quốc tế)Tiếng Anh (Mỹ, quốc tế tổ hợp Unicode AltGr)Tiếng Anh (Mỹ, Quốc tế tổ hợp Unicode AltGr, thay thế)Tiếng Anh (Mỹ, quốc tế với phím chết)Tiếng Anh (Mỹ với euro trên 5)Tiếng Anh (Workman)Tiếng Anh (Workman quốc tế với phím chết)Tiếng Anh (Dvorak cổ điển)Tiếng Anh (Quốc tế với phím chết AltGr)Tiếng Anh (Dvorak cho người thuận tay trái)Tiếng Anh (Dvorak cho người thuận tay phải)Tiếng Anh (các phím chia/nhân bật tắt bố cục)Ennyah DKB-1008Enter trên vùng phímTiếng Ét-pe-ran-tôQuốc tế ngữ (Bra-xin, Nativo)Tiếng Ét-pê-ran-to (Bồ Đào Nha, Nguyên gốc)Ét-pe-ran-tô (hoán đổi dấu chấm phẩy và dấu nháy, cũ)Tiếng Et-tô-ni-aTiếng Et-tô-ni-a (Dvorak)Tiếng Ét-tôn-nia (Kiểu Sun 6/7)Tiếng Et-tô-ni-a (bàn phím Mỹ với các chữ cái E-x-tô-ni-a)Tiếng Et-tô-ni-a (loại bỏ phím chết)EurKEY (Bố cục Mỹ với các chữ cái châu âu)Euro trên 2Euro trên 4Euro trên 5Euro trên EEverex STEPnoteEweFL90Tiếng Pha-rôTiếng Pha-rô (loại bỏ phím chết)Tiếng Phi-li-pinTiếng Phi-li-pin (Capewell-Dvorak Baybayin)Tiếng Phi-li-pin (Capewell-Dvorak Latin)Tiếng Phi-li-pin (Capewell-QWERF 2006 Baybayin)Tiếng Phi-li-pin (Capewell-QWERF 2006 Latin)Tiếng Phi-li-pin (Colemak Baybayin)Tiếng Phi-li-pin (Colemak Latin)Tiếng Phi-li-pin (Dvorak Baybayin)Tiếng Phi-li-pin (Dvorak Latin)Tiếng Phi-li-pin (QWERTY Baybayin)Tiếng Phần LanTiếng Phần Lan (DAS)Tiếng Phần Lan (Macintosh)Tiếng Phần Lan (Kiểu Sun 6/7)Tiếng Phần Lan (Có phím Win)Tiếng Phần Lan (cổ điển)Tiếng Phần Lan (cổ điển, loại trừ phím chết)Phím bốn bậc có bộ phân cách ảoPhím bốn bậc có dấu phẩyPhím bốn bậc có chấmPhím bốn bậc có chấm, chỉ Latin-9Phím bốn bậc có momayyezPhápTiếng Pháp (Azerty)Tiếng Pháp (Bepo, tối ưu nhân tố, cách Dvorak)Tiếng Pháp (Bepo, tối ưu nhân tố, cách Dvorak, chỉ Latin-9)Tiếng Pháp (Breton)Tiếng Pháp (Ca-mơ-run)Tiếng Pháp (Ca-na-đa)Tiếng Pháp (Ca-na-đa, Dvorak)Tiếng Pháp (Ca-na-đa, cổ)Tiếng Pháp (Cộng Hòa Dân Chủ Công-gô)Tiếng Pháp (Dvorak)Tiếng Pháp (Ghi-nê Xích Đạo)Tiếng Pháp (Macintosh)Pháp (Mali, thay thế)Tiếng Pháp (Ma Rốc)Tiếng Pháp (Kiểu Sun 6/7)Tiếng Pháp (phím chết Sun)Tiếng Pháp (Thụy sỹ)Tiếng Pháp (Thụy Sỹ, Macintosh)Tiếng Pháp (Thụy Sỹ, Kiểu Sun 6/7)Tiếng Pháp (Thụy Sỹ, phím chết Sun)Tiếng Pháp (Thụy Sỹ, loại bỏ phím chết)Tiếng Pháp (Tô gô)Tiếng Pháp (thư mục dữ liệu thay thế)Tiếng Pháp (thay thế, chỉ Latin-9)Tiếng Pháp (thay thế, phím chết Sun)Tiếng Pháp (thay thế, loại bỏ phím chết)Tiếng Pháp (loại bỏ phím chết)Tiếng Pháp (cũ, thay thế)Tiếng Pháp (cổ, thay thế, phím chết Sun,Tiếng Pháp (cổ, thay thế, loại bỏ phím chết)Máy tính xách tay AMILO Fujitsu-SiemensFulaGaPC chung 101 phímPC chung 102 phím (Quốc tế)PC chung 104 phímPC chung 105 phím (Quốc tế)Genius Comfy KB-12eGenius Tiện lợi KB-16M / Bàn phím Genius MM KWD-910Genius Comfy KB-21e-ScrollGenius KB-19e NBGenius KKB-2050HSGi-oa-gi-aTiếng Óc-khi-tanh (Pháp, AZERTY Tskapo)Tiếng Gi-oa-gi-a (Ý)Tiếng Gi-oa-gi-a (MESS)Tiếng Gi-oa-gi-a (ergonomic)Tiếng ĐứcTiếng Đức (Aus der Neo-Welt)Tiếng Đức (Áo)Tiếng Đức (Áo, Macintosh)Tiếng Đức (Áo, phím chết Sun)Tiếng Đức (Áo, loại bỏ phím chết)Tiếng Đức (Bone)Tiếng Đức (Bone, mũi tên eszett home)Tiếng Đức (Dvorak)Tiếng Đức (KOYT)Tiếng Đức (Macintosh)Tiếng Đức (Macintosh, loại bỏ phím chết)Tiếng Đức (Neo 2)Tiếng Đức (qwerty hiện đại)Tiếng Đức (qwertz hiện đại)Tiếng Đức (Kiểu Sun 6/7)Tiếng Đức (phím chết Sun)Tiếng Đức (Thụy sỹ)Tiếng Đức (Thụy Sỹ, Macintosh)Tiếng Đức (Thụy Sỹ, Kiểu Sun 6/7)Tiếng Đức (Thụy Sỹ, phím chết Sun)Tiếng Đức (Thụy Sỹ, loại bỏ phím chết)Tiếng Đức (Thụy Sỹ, cũ)Tiếng Đức (T3)Tiếng Đức (Bàn phím Mỹ với các chữ cái Đức)Tiếng Đức (dấu sắc chết)Tiếng Đức (dấu huyền chết)Tiếng Đức (dấu sóng chết)Tiếng Đức (loại bỏ phím chết)Tiếng Đức (qwerty)Tiếng Đức (có chữ Hung-ga-ri và không có phím chếtTiếng Hy LạpTiếng Hy Lạp (Kiểu Sun 6/7)Hy-lạp (loại bỏ phím chết)Tiếng Hy Lạp (mở rộng)Tiếng Hy Lạp (đa giọng)Tiếng Huy Lạp (đơn giản)Tiếng Gu-gia-ra-tiGyrationHTC DreamBàn phím Happy HackingBàn phím Happy Hacking cho MacPhím Hangul/Hanja phần cứngHau-xaTiếng Do TháiTiếng Hê-brơ (Do thái) (Kinh thánh, ngữ âm SIL)Tiếng Do Thái (Kinh thánh, Tiro)Tiếng Do Thái (lyx)Tiếng Do Thái (ngữ âm)Bàn phím Internet Hewlett-PackardHewlett-Packard Mini 110 NotebookHewlett-Packard Omnibook 500 FAHewlett-Packard Omnibook 5xxHewlett-Packard Omnibook 6000/6100Hewlett-Packard Omnibook XE3 GCHewlett-Packard Omnibook XE3 GFHewlett-Packard Omnibook XT1000Hewlett-Packard Pavilion ZT11xxHewlett-Packard Pavilion dv5Bàn phím đa phương tiện Hewlett-Packard SK-250xHewlett-Packard nx9020Thập lục phânTiếng Hin-đi (Bolnagri)Tiếng Hin-đi (ngữ âm KaGaPa)Tiếng Hin-đi (Wx)Honeywell EuroboardĐiện thoại Htc DreamTiếng Hung Ga riTiếng Hung Ga ri (101/qwerty/dấu phẩy/Phím chết)Tiếng Hung Ga ri (101/qwerty/dấu phẩy/loại bỏ phím chết)Tiếng Hung Ga ri (101/qwerty/dấu chấm/Phím chết)Tiếng Hung Ga ri (101/qwerty/dấu chấm/loại bỏ phím chết)Tiếng Hung Ga ri (101/qwertz/dấu phẩy/Phím chết)Tiếng Hung Ga ri (101/qwertz/dấu phẩy/loại bỏ phím chết)Tiếng Hung Ga ri (101/qwertz/dấu chấm/Phím chết)Tiếng Hung Ga ri (101/qwertz/dấu chấm/loại bỏ phím chết)Tiếng Hung-ga-ri (102/qwerty/dấu phẩy/Phím chết)Tiếng Hung-ga-ri (102/qwerty/dấu phẩy/loại bỏ phím chết)Tiếng Hung-ga-ri (102/qwerty/dấu chấm/Phím chết)Tiếng Hung-ga-ri (102/qwerty/dấu chấm/loại bỏ phím chết)Tiếng Hung Ga ri (102/qwertz/dấu phẩy/Phím chết)Tiếng Hung-ga-ri (102/qwertz/dấu phẩy/loại bỏ phím chết)Tiếng Hung-ga-ri (102/qwertz/dấu chấm/Phím chết)Tiếng Hung-ga-ri (102/qwertz/dấu chấm/loại bỏ phím chết)Tiếng Hung Ga ri (loại bỏ phím chết)Tiếng Hun-ga-ri (qwerty)Tiếng Hung Ga ri (tiêu chuẩn)Hyper ánh xạ tới các phím WinTruy cập nhanh IBMTruy cập nhanh IBM IIIBM Space SaverIBM ThinkPad 560Z/600/600E/A22EIBM ThinkPad R60/T60/R61/T61IBM ThinkPad Z60m/Z60t/Z61m/Z61tTiếng AixơlenTiếng Ai-xơ-len (Dvorak)Tiếng Ai-len (Macintosh)Tiếng Ai-len (Macintosh, cũ)Tiếng Ai-len (phím chết Sun)Tiếng Ai-len (loại bỏ phím chết)Tiếng Ig-bôTiếng Ấn ĐộI-nukh-ti-tu-thTiếng I-rắcTiếng Ai-lenAi-len (UnicodeExpert)Tiếng ÝTiếng Ý (IBM 142)Tiếng Ý (Macintosh)Tiếng Ý (Kiểu Sun 6/7)Tiếng Ý (Bàn phím Mỹ với các chữ cái Ý)Tiếng Ý (Có phím Windows)Tiếng Ý (loại bỏ phím chết)Tiếng NhậtTiếng Nhật (Dvorak)Tiếng Nhật (Kana 86)Tiếng Nhật (Kana)Tiếng Nhật (Macintosh)Tiếng Nhật (OADG 109A)Tiếng Nhật (Sê-ri PC-98xx)Tiếng Nhật (Kiểu Sun 6/7)Tiếng Nhật (Kiểu Sun 7 - tương thích pc)Tiếng Nhật (Kiểu Sun 7 - tương thích sun)Tùy chọn bàn phím tiếng NhậtTiếng KalmykPhím Kana Lock sẽ khóaKannadaKannada (ngữ âm KaGaPa)Tiếng Kha-su-biTiếng Ca-dakhTiếng Kha-xắc (mở rộng)Tiếng Kha-xắc (với tiếng Nga)Tổ hợp phím để kết thúc XPhím để chọn cấp baPhím để chọn cấp 5Keytronic FlexProTiếng Khơ-me (Cam Pu Chia)Tiếng Ki-ku-yuKinesisTiếng KomiTiếng Hàn QuốcTiếng Hàn Quốc (tương thích với kiểu bàn phím 101/104)Tiếng Hàn (Kiểu Sun 6/7)Phím Hangul/Hanja Hàn QuốcTiếng Kuổ-đít (Iran, A Rập La-tinh)Tiếng Kuổ-đít (I ran, F)Tiếng Kuổ-đít (I ran, La-tinh Alt-Q)Tiếng Kuổ-đít (I ran, La-tinh Q)Tiếng Iran (I-rắc, Ả Rập La-tinh)Tiếng Iran (I-rắc, F)Tiếng Iran (I-rắc, La-tinh Alt-Q)Tiếng Iran (Irắc, La-tinh Q)Tiếng A Rập (Xy-ri)Tiếng Iran (I-rắc, La-tinh Alt-Q)Tiếng Kuổ-đít (Iran, A Rập La-tinh)Tiếng Kuổ-đít (Thổ Nhĩ Kỳ, F)Tiếng Iran (I-rắc, La-tinh Alt-Q)Tiếng Kuổ-đít (Iran, A Rập La-tinh)Tiếng Cu-ten-aiTiếng Khư-rơ-gư-xtanhTiếng Khư-rơ-gư-xtanh (ngữ âm)LàoLào (bố cục STEA tiêu chuẩn dự kiến)Bàn phím nhỏ gọn cho máy xách tay/notebook Compaq (ví dụ Armada)Bàn phím Internet cho máy xách tay/notebook Compaq (ví dụ Presario)Máy tính xách tay eMachines m68xxTiếng Lát-vi-aTiếng Lát-vi-a (biến thể F)Tiếng Lát-vi-a (Kiểu Sun 6/7)Tiếng Lát-vi-a (US Colemak)Tiếng Lát-vi-a (US Colemak, biến thể nháy đơn)Tiếng Lát-vi-a (US Dvorak)Tiếng Lát-vi-a (US Dvorak, biến thể Y)Tiếng Lát-vi-a (US Dvorak, biến thể dấu trừ)Tiếng Lát-vi-a (vay mượn)Tiếng Lát-vi-a (biến thể hô ngữ)Tiếng Lát-vi-a  (công thái học, ŪGJRMV)Tiếng Lát-vi-a (hiện đại)Tiếng Lát-vi-a (US Dvorak dành cho người lập trình)Tiếng Lát-vi-a (US Dvorak dành cho người lập trình, biến thể Y)Tiếng Lát-vi-a (US Dvorak dành cho người lập trình,biến thể dấu trừ)Tiếng Lát-vi-a (biến thể dấu sóng ~)Bố trí vùng phím sốAlt tráiAlt trái (trong khi bấm)Alt trái là Ctrl, Ctrl trái là Win, Win trái là AltAlt trái được tráo đổi với phím Win tráiAlt trái + Sift tráiCtrl tráiCtrl trái (tới bố trí đầu tiên), Ctrl phải (tới bố trí cuối cùng)Ctrl trái là MetaCtrl trái+Shift tráiShift tráiWin tráiWin trái (tới bố trí đầu tiên), Win phải/Trình đơn (tới bố trí cuối cùng)Win trái (trong khi bấm)Win trái chọn cấp 5, khóa khi bấm nhau với một bộ chọn năm 5 khácCtrlTrái+WinTráiCtrl trái + Win trái (chuyển đến bố trí đầu tiên), Ctrl phải+Menu (tới bố trí thứ hai)Thừa tựWang 724 cũPhím thừa tự có dấu phẩyPhím thừa tự có chấmTiếng Li-tu-a-niTiếng Li-tu-a-ni (IBM LST 1205-92)Tiếng Li-tu-a-ni (LEKP)Tiếng Li-tu-a-ni (LEKPa)Tiếng Lát-vi (Kiểu Sun 6/7)Tiếng Li-tu-a-nia (Bàn phím Dvorak Mỹ với các chữ cái Li-tu-a-nia)Tiếng Li-tu-a-ni (Bàn phím Mỹ với các chữ cái Li-tu-a-nia)Tiếng Li-tu-a-ni (tiêu chuẩn)Bàn phím Truy cập LogitechLogitech Cordless DesktopLogitech Cordless Desktop (tùy chọn thay thế)Logitech Cordless Desktop EX110Logitech Cordless Desktop LX-300Logitech Cordless Desktop NavigatorLogitech Cordless Desktop OpticalLogitech Cordless Desktop Pro (tùy chọn thay thế 2)Logitech Cordless Desktop iTouchLogitech Cordless Freedom/Desktop NavigatorLogitech G15 các phím thêm thông qua G15daemonBàn phím chung LogitechBàn phím Internet Logitech 350Bàn phím Internet LogitechBàn phím Logitech Internet NavigatorBàn phím Logitech Media EliteBàn phím Logitech Ultra-X Cordless Media DesktopBàn phím Logitech Ultra-XBàn phím Logitech diNovo EdgeBàn phím Logitech diNovoLogitech iTouchBàn phím Không dây Logitech iTouch (mẫu mã Y-RB6)Bàn phím Logitech iTouch Internet Navigator SEBàn phím Logitech iTouch Internet Navigator SE (USB)Tiếng Xoa-bi ThấpTiếng Xoa-bi Thấp (qwertz)MacBook/MacBook ProMacBook/MacBook Pro (quốc tế)Tiếng MaxêđôniTiếng Maxêđôni (loại bỏ phím chết)MacintoshMacintosh CũBảo trì phím tương thích với mã Solaris cũ.Đặt CapsLock làm một phím Xóa lùi bổ sungĐặt CapsLock làm một phím ESC bổ sungĐặt CapsLock làm một phím Hyper bổ sungĐặt CapsLock làm một phím Menu bổ sungĐặt CapsLock làm một phím NumLock bổ sungĐặt CapsLock làm một phím Super bổ sungĐặt Zenkaku Hankaku làm một phím ESC bổ sungTiếng Mã-laiTiếng Mã-lai (Lalitha)Tiếng Mã-lai (Inscript tăng cường, với dấu rupee)Tiếng MantơTiếng Mantơ (có bố trí Mỹ)Tiếng Manipuri (Eeyek)Tiếng Mao-riTiếng Marathi (ngữ âm KaGaPa)Tiếng Ma-riMemorex MX1998Bàn phím Memorex MX2500 EZ-AccessMemorex MX2750Trình đơnCtrl phải làm Trình đơnMeta ánh xạ tới Win tráiMeta ánh xạ tới các phím WinMicrosoft Comfort Curve Keyboard 2000Bàn phím Internet MicrosoftBàn phím Internet Microsoft Pro, Thụy ĐiểnMicrosoft NaturalMicrosoft Natural Ergonomic Keyboard 4000Microsoft Natural Keyboard EliteMicrosoft Natural Keyboard Pro / Microsoft Internet Keyboard ProMicrosoft Natural Keyboard Pro OEMMicrosoft Natural Keyboard Pro USB / Microsoft Internet Keyboard ProMicrosoft Natural Wireless Ergonomic Keyboard 7000Bàn phím Văn phòng MicrosoftMicrosoft Wireless Multimedia Keyboard 1.0ATùy chọn tương thích khácMmuockTiếng Moa-đô-vaTiếng Mon-đa-vi (Gagauz)Tiếng Mông CổTiếng MontenegrinTiếng Montenegrin (Ki-rin có “guillemets”)Tiếng Montenegrin (Ki-rin)Tiếng Montenegrin (Ki-rin, đổi chỗ Z và ZHE)Tiếng Montenegrin (La-tinh Unicode qwerty)Tiếng Montenegrin (La-tinh Unicode)Tiếng Montenegrin (La-tinh qwerty)Tiếng Montenegrin (La-tinh có “guillemets”)Đa ngữ (Canada, Kiểu Sun 6/7)Xóa lùi kiểu NICOLA-FTiếng Nê-panKý tự dấu cách không thể ngắt ở bậc thứ tưKý tự dấu cách không thể ngắt ở bậc thứ tư, ký tự dấu cách không thể ngắt mảnh ở bậc thứ sáuKý tự dấu cách không thể ngắt ở bậc thứ tư, ký tự dấu cách không thể ngắt mảnh ở bậc thứ sáu (dùng Ctrl+Shift)Ký tự dấu cách không thể ngắt ở bậc thứ haiKý tự dấu cách không thể ngắt ở bậc thứ baKý tự dấu cách không thể ngắt ở bậc thứ ba, không nhập gì ở bậc thứ tưKý tự dấu cách không thể ngắt ở bậc thứ ba, ký tự dấu cách không thể ngắt mảnh ở bậc thứ tưTiếng Bắc Xa-mi (Phần Lan)Tiếng Bắc Xa-mi (Na Uy)Tiếng Bắc Xa-mi (Na Uy, loại bỏ phím chết)Tiếng Bắc Xa-mi (Thụy Điển)Northgate OmniKey 101Tiếng Na-uyTiếng Na-uy (Colemak)Tiếng Na Uy (Dvorak)Tiếng Na Uy (Macintosh)Tiếng Na Uy (Macintosh, loại bỏ phím chết)Tiếng Na Uy (Kiểu Sun 6/7)Tiếng Na Uy (Có phím Windows)Tiếng Na Uy (loại bỏ phím chết)NumLockNumLock bật: chữ số, Shift chuyển thành phím mũi tên, Numlock tắt: luôn dùng phím mũi tên (giống như trong MS Windows)Ứng xử phím xóa của vùng sốPhím vùng số luôn nhập số (như trên HDH Mac)OLPCTiếng Óc-khi-tanhOg-âmTiếng Ogam (IS434)Ol ChikiÔ-ri-aBàn phím Ortek MCK-800 MM/InternetTiếng Ossetian (Georgia)Tiếng O-set (WinKeys)Tiếng O-set (cổ)Sê ri PC-98xxTiếng Đồng điệu Ru-xin Pa-nonTiếng Pas-tôTiếng Pas-tô (Áp-ga-nít-xtan, OLPC)PauseTiếng Ba TưTiếng Persian (Áp-ga-nít-xtan, Dari OLPC)Tiếng Ba Tư (có vùng phím Ba Tư)Tiếng Ba LanTiếng Ba Lan (Colemak)Tiếng Ba Lan (Dvorak)Tiếng Ba Lan (Dvorak, dấu ngoặc tiếng Ba Lan trên phím 1)Tiếng Ba Lan (Dvorak, dấu ngoặc Polish trên phím đánh dấu ngoặc)Tiếng Ba Lan (Đức, loại bỏ phím chết)Tiếng Ba Lan (Kiểu Sun 6/7)Tiếng Ba Lan (quốc tế với phím chết)Tiếng Ba Lan (cổ)Tiếng Ba Lan (dành cho người lập trình)Tiếng Ba Lan (qwertz)Tiếng Bồ Đào NhaBồ Đào Nha (Bra-xin)Bồ Đào Nha (Bra-xin, Dvorak)Bồ Đào Nha (Bra-xin, IBM/Lenovo ThinkPad)Bồ Đào Nha (Bra-xin, Nativo cho bàn phím Mỹ)Bồ Đào Nha (Brazil, Nativo)Tiếng Bồ Đào Nha (Bra-xin, Kiểu Sun 6/7)Bồ Đào Nha (Bra-xin, loại bỏ phím chết)Tiếng Bồ Đào Nha (Macintosh)Tiếng Bồ Đào Nha (Macintosh, phím chết Sun)Tiếng Bồ Đào Nha (Macintosh, loại bỏ phím chết)Tiếng Bồ Đào Nha (Nativo cho bàn phím Mỹ)Tiếng Bồ Đào Nha (Nativo)Tiếng Bồ Đào Nha (Kiểu Sun 6/7)Tiếng Bồ Đào Nha (phím chết Sun)Tiếng Bồ Đào Nha (loại bỏ phím chết)Vị trí phím ComposePropeller Voyager (KTEZ-1000)PrtScTiếng Punjabi (Gổ-mu-khi Jhelum)Tiếng Punjabi (Gổ-mu-khi)QTronix Scorpius 98N+Alt phảiAlt phải (trong khi bấm)Alt phải như là Hangul, Ctrl phải là HanjaAlt phải chọn cấp 5, khóa khi bấm nhau với một bộ chọn cấp 5 khácPhím Alt bên phải không bao giờ chọn bậc thứ 3Alt phải, phím Shift+ Alt phải là ComposeCtrl phảiCtrl phải (trong khi bấm)Ctrl phải làmHangul, Alt phải là HanjaCtrl phải làm Alt phảiCtrl phải + Shift phảiShift phảiWin phảiWin phải (trong khi bấm)Win phải chọn cấp 5, khóa khi bấm nhau với một bộ chọn cấp 5 khácTiếng Ru-ma-niTiếng Ru-ma-ny (Đức)Tiếng Ru-ma-ny (Đức, loại bỏ phím chết)Tiếng Ru-ma-ni (Kiểu Sun 6/7)Tiếng Ru-man-ni (Có phím Windows)Tiếng Ru-man-ni (cedilla)Tiếng Ru-ma-ni (Touchtype sinh thái công)Tiếng Ru-man-ni (dấu phẩy tiêu chuẩn)Tiếng Ru-man-ni (tiêu chuẩn)Ru pi trên 4Tiếng NgaTiếng Nga (Séc, ngữ âm)Tiếng Nga (DOS)Tiếng Nga (Georgia)Tiếng Nga (Đức, ngữ âm)Tiếng Nga (Ka-zắc-tan, có Kha-xắc)Tiếng Nga (Macintosh)Tiếng Ru-man-ni (Ba Lan, ngữ âm Dvorak)Tiếng Nga (Rulemak, ngữ âm Colemak)Tiếng Nga (Kiểu Sun 6/7)Tiếng Nga (Thụy Điển, ngữ âm)Tiếng Nga (Thụy Điển, ngữ âm, loại bỏ phím chết)Tiếng Nga (Mỹ, ngữ âm)Tiếng Nga (U-crai-na, RSTU chuẩn)Tiếng Nga (cổ)Tiếng Nga (Pháp ngữ âm)Tiếng Nga (ngữ âm, phím Win)Tiếng Nga (ngữ âm azerty)Tiếng Nga (dvorak ngữ âm)Tiếng Nga (ngữ âm)Tiếng Nga (máy chữ)Tiếng Nga (máy chữ, kiểu cũ)Tiếng Nga (với bố trí Ucrai-na Belorussian)Bàn phím Không dây Đa phương tiện SILVERCRESTSK-1300SK-2500SK-6200SK-7100SVEN Ergonomic 2500SVEN Slim 303Tiếng Saisiyat (Đài-loan)Samsung SDM 4500PSamsung SDM 4510PTiếng Sanskrit (ngữ âm KaGaPa)Sanwa áp dụng SKB-KG3Scroll LockSecwepemctsinDấu chấm phẩy ở cấp baTiếng Xéc-biTiếng Xéc-bi (Ki-rin với “guillemets”)Tiếng Xéc-bi (Ki-rin, đổi chỗ Z và ZHE)Tiếng Xéc-bi (La-tinh Unicode qwerty)Tiếng Xéc-bi (La-tinh Unicode)Tiếng Xéc-bi (La-tinh qwerty)Tiếng Xéc-bi (La-tinh với “guillemets”)Tiếng Xéc-bi (La-tinh)Tiếng Xéc-bi (Nga)Tiếng Xéc-bi (tổ hợp dấu phụ thay cho phím chết)Tiếng Serbo-Crô-oát (Mỹ)Shift + NumLock bật/tắt PointerKeysShift thôi CapsLockShift không hủy Numlock, chọn cấp 3 để thay thếShift+CapsLockTiếng SilesianTiếng Xin-điTiếng Sinhala (Bàn phím Mỹ với các chữ cái Sinhala)Tiếng Sinhala (ngữ âm)Tiếng Xlô-vácTiếng X-lô-vác (Kiểu Sun 6/7)Tiếng Xlô vác (gạch ngược Mở rộng)Tiếng Xlô vác (qwerty)Tiếng Xlô vác (qwerty, Gạch ngược mở rộng)Tiếng Xlô-venTiếng Xlô-ven (Bàn phím Mỹ với các chữ cái Xlô-ven)Tiếng Xlô-ven (Dùng “guillemets” làm dấu trích dẫn)Tiếng Tây Ban NhaTiếng Tây Ban Nha (Dvorak)Tiếng Tây Ban Nha (Mỹ La-tinh)Tiếng Tây Ban Nha (Mỹ La-tinh, Dvorak)Tiếng Tây Ban Nha (Mỹ La-tinh, phím chết sun)Tiếng Tây Ban Nha (Mỹ La-tinh, loại bỏ phím chết)Tiếng Tây Ban Nha (Mỹ La-tinh, có phím chết)Tiếng Tây Ban Nha (Macintosh)Tiếng Tây Ban Nha (Kiểu Sun 6/7)Tiếng Tây Ban Nha (phím chết Sun)Tây Ban Nha (Có phím Windows)Tây Ban Nha (loại bỏ phím chết)Tây Ban Nha (bao gồm dấu sóng chết)Các ký tự đặc biệt (Ctrl+Alt+&lt;key&gt;) được xử lý bằng một trình phục vụTương thích phím SunKiểu Sun 6 (Bố cục Nhật Bản)Kiểu Sun 6 USB (Bố cục Nhật Bản)Kiểu Sun 6 USB (Bố cục Unix)Kiểu Sun 6/7 USBKiểu Sun 6/7 USB (Bố cục Châu Âu)Kiểu Sun 7 USBKiểu Sun 7 USB (Bố cục Châu Âu)Kiểu Sun 7 USB (Bố cục Nhật Bản) / 106 phím Nhật BảnKiểu Sun 7 USB (Bố cục Unix)Bàn phím đa phương tiện Siêu Năng LựcTiếng Bantu (Kenya)Tiếng Bantu (Tanzania)Trao đổi Ctrl và CapsLockTrao đổi ESC và CapsLockHoán đổi Alt trái với phím Ctrl tráiHoán đổi Win trái với phím Ctrl tráiHoán đổi Win phải với phím Ctrl phảiTiếng Thụy ĐiểnTiếng Thụy Điển (Dvorak A5)Tiếng Thụy Điển (Dvorak)Tiếng Thụy Điển (Macintosh)Tiếng Thụy Điển (Kiểu Sun 6/7)Thụy Điển (Svdvorak)Tiếng Thụy Điển (loại bỏ phím chết)Thụy Điển ngôn ngữ ký hiệuChuyển sang bố cục khácSymplon PaceBook (tablet PC)Tiếng Xi-riTiếng Syriac (ngữ âm)Tiếng Đài LoanTiếng Đài Loan (bản địa)Tiếng Ta-gicTiếng Ta-gíc (cổ)Tiếng Ta-minTiếng Ta-min (Xri-lan-ca, TAB máy chữ)Tiếng Ta-min (Xri-lan-ca, Unicode)Tiếng Ta-min (TAB máy chữ)Tiếng Ta-min (TSCII máy chữ)Tiếng Ta-min (Unicode)Tiếng Ta-min (Bàn phím với các chữ số)Targa Visionary 811Ta-tăTiếng Te-lu-guTiếng Te-lu-gu (ngữ âm KaGaPa)Tiếng Thái LanTiếng Thái Lan (Pattachote)Tiếng Thái (TIS-820.2538)Tiếng Tây TạngTiếng Tây Tạng (có chữ số ASCII)Để tương ứng phím trên một bố trí ColemakĐể tương ứng phím trên một bố trí DvorakĐể tương ứng phím trên một bố trí QwertyToshiba Satellite S3000Truly Ergonomic Computer Keyboard Model 227 (Wide Alt keys)Truly Ergonomic Computer Keyboard Model 229 (Standard sized Alt keys, additional Super and Menu key)Bàn phím Truy cập Thẳng Tin tưởngTrust SlimlineBàn Phím Cổ điển Không dây Tin tưởngTiếng T-xoua-naTiếng Thổ Nhĩ KỳTiếng Thổ nhĩ kỳ (Alt-Q)Tiếng Thổ Nhĩ Kỳ (F)Thổ Nhĩ Kỳ (Đức)Tiếng Thổ Nhĩ Kỳ (Kiểu Sun 6/7)Tiếng Bồ Đào Nha (phím chết Sun)Tiếng Thổ Nhĩ Kỳ (quốc tế với phím chết)Tiếng TuôcmenTiếng Tuôcmen (Alt-Q)TypeMatrix EZ-Reach 2020TypeMatrix EZ-Reach 2030 PS2TypeMatrix EZ-Reach 2030 USBTypeMatrix EZ-Reach 2030 USB (chế độ 102/105:EU)TypeMatrix EZ-Reach 2030 USB (chế độ 106:JP)Tiếng U-đ-muổtTiếng UkrainaTiếng U-crai-na (Kiểu Sun 6/7)Tiếng U-crai-na(Có phím Windows)Tiếng U-crai-na (phát âm giống nhau)Tiếng U-crai-na (cổ)Tiếng U-crai-na (ngữ âm)Tiếng U-crai-na (RSTU chuẩn)Tiếng U-crai-na (máy đánh chữ)Phần thêm Unicode (các mũi tên và toán tử toán học)Phần thêm Unicode (các mũi tên và toán tử toán học; toán tử toán học ở mức mặc định)Unitek KB-1925Tiếng Ua-đu (Pa-ki-x-thănh)Tiếng Ua-đu (Pa-ki-x-thănh, CRULP)Tiếng Ua-đu (Pa-ki-x-thănh, NLA)Tiếng Urdu (WinKeys)Tiếng Urdu (ngữ âm thay thế)Tiếng Urdu (ngữ âm)Sử dụng đèn bàn phím để chỉ ra bố trí xen kẽDùng phím dài để nhập ký tự dấu cách không thể ngắtDấu cách bình thường ở mọi bậcTiếng UyghurTiếng U-dơ-bếchTiếng U-x-béc (Áp-ga-nít-xtan)Tiếng U-x-béc (Áp-ga-nít-xtan, OLPC)Tiếng U-x-béc (La-tinh)Tiếng ViệtBàn phím Internet ViewSonic KU-306Vùng phím Wang 724 có phần thêm Unicode (các mũi tên và toán tử toán học)Vùng phím Wang 724 có phần thêm Unicode (các mũi tên và toán tử toán học; toán tử toán học ở mức mặc định)Phím Win+SpaceWin ánh xạ tới các phím PrtSc (và các phím Win thường dùng)Winbook kiểu mẫu XP5WolofBàn phím Internet Yahoo!Tiếng Ya-khú-thTiếng Yoa-ru-baKý tự không nối có chiều rộng không tại cấp 2Ký tự không nối có chiều rộng không tại cấp 2, ký tự dấu cách không thể ngắt ở cấp 3Ký tự không nối có chiều rộng không tại cấp 2, ký tự dấu cách không thể ngắt ở cấp 3, không có gì ở cấp 4Ký tự không nối có chiều rộng không tại cấp 2, ký tự dấu cách không thể ngắt ở cấp 3, ký tự dấu cách mảnh không thể ngắt ở cấp 4Ký tự không nối có chiều rộng không tại cấp 2, ký tự dấu cách không thể ngắt ở cấp 3, ký tự nối có chiều rộng không ở cấp 4Ký tự không nối có chiều rộng không tại cấp 2, ký tự nối có chiều rộng không ở cấp 3Ký tự không nối có chiều rộng không tại cấp 2, ký tự nối có chiều rộng không ở cấp 3, ký tự dấu cách không thể ngắt ở cấp 4Ký tự không nối có chiều rộng không tại cấp 3, ký tự nối có chiều rộng không ở cấp 4akamaplapl2aplIIaplxaravnazbeberbgbmbnbrlbsbychrcmcrhcsdadedlgdvdzeeeneoeseteufafffifofrfr-tggaagaggrguhahehihrhuhyieigikeinbằngitjakakikkkmknkokukutlaloltlvmdmimkmlmnmrmtmynenlnoorpaphplpsptrorusasasaxsdshssiskslsqsrsvswsyctatetgthtktntrufdugukurusuzviwoxsyyozh